Accessibility
_Last updated: 2026-09-07_
This document applies to the public website operated for Fireplace Draft Chimney Service (Chimney Sweep & Inspection), with a listed business location at 414 2nd St., Westlake, OH. Phone: 14403488654. Email: office@fireplacedraftchimneyservice.site. Questions about this document can be directed to email office@fireplacedraftchimneyservice.site.
Commitment
Fireplace Draft Chimney Service aims to make website information and contact options usable by a broad audience, including people who use assistive technologies. This Accessibility Statement describes our approach and limitations. It does not claim formal certification, third-party audit completion, or full conformance with WCAG, ADA Title III case law, or any other specific standard unless such a claim is separately published in writing by the business.
Accessibility Features We Strive to Support
Where practical, pages are structured with semantic headings, descriptive link text, form labels, sufficient color contrast targets, keyboard-focusable controls, and text that can be resized with browser zoom. Visitors may use browser zoom, text-size controls, high-contrast modes, screen readers, voice input, switch controls, and other assistive technology supported by their browser and device. Contact telephone links (tel:) and email links are provided so users who prefer phone or email are not forced to complete a web form.
Known and Potential Limitations
Automated site generation, third-party map embeds, complex media, PDFs, older blog content, or third-party widgets can introduce barriers. Some interactive components may not yet expose every ARIA state ideally. Captions or transcripts may be incomplete for certain media. A feature that works in one browser or screen-reader combination may behave differently in another. Listing these risks is honesty—not a waiver of the commitment to improve.
How to Request Assistance
If you cannot access information, complete a service request, or use a page feature, contact Fireplace Draft Chimney Service by phone or email using the details published on this site (email office@fireplacedraftchimneyservice.site). Please include: (1) the page URL; (2) the task you were trying to complete; (3) the barrier you encountered; (4) your browser or assistive technology if you are comfortable sharing it; and (5) your preferred response method. Reasonable alternative formats or assistance (for example, completing a request by phone) will be considered in good faith.
Ongoing Improvements
Accessibility is an ongoing effort. Content, templates, and third-party tools change over time. Feedback from customers and visitors helps identify issues that automated checkers miss. When barriers are reported, Fireplace Draft Chimney Service will review them and prioritize fixes or alternative access paths as resources allow. Related pages: Contact, Privacy Policy, and Terms of Service.
Scope
This statement applies to the public marketing website for Fireplace Draft Chimney Service at the published domain. It does not automatically cover third-party portals, payment processors, social networks, or linked government or manufacturer sites that open outside this domain.